PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG044596t3
Common NameTCM_044596
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family bZIP
Protein Properties Length: 312aa    MW: 34717.1 Da    PI: 8.6755
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG044596t3genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_151.81.8e-16250294448
                       XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkke 48 
                       ++r++r++kNRe+A rsR+RK+a++ eLe+kv  Le+eN +Lk++
  Thecc1EG044596t3 250 DRRQKRMIKNRESAARSRARKQAYTNELENKVSRLEEENARLKDR 294
                       79****************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.9E-15241294No hitNo description
SMARTSM003381.2E-14247311IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.277249294IPR004827Basic-leucine zipper domain
PfamPF001704.1E-14250294IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.5E-12251305No hitNo description
CDDcd147071.65E-22251302No hitNo description
PROSITE patternPS000360254269IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009737Biological Processresponse to abscisic acid
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MGIQTMVSQG DSGSNGKESQ FQQLTRQNSM YSLTLDEVQN QLGDLGKPLS SMNLDELLKN  60
VWTAEANQNY GMETEGTALT NQTALQRQSS LSLTSALSKK TVDEVWRDIQ QSKNDGEKKY  120
RERQPTLGEM TLEDFLVKAG VVAEASTDKK GGGSVAGVDL SVAPQFAQQG QWMQYPQPQY  180
QHPQQSLMGV YMSAQPMPQP LTIGATAVMD VSYPDNQVPL PSPLMGTLSD TQASGRKRGA  240
PEDMIEKNVD RRQKRMIKNR ESAARSRARK QAYTNELENK VSRLEEENAR LKDRKLFLVQ  300
LSSILRHYPI I*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00409DAPTransfer from AT3G56850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007010667.10.0BZIP domain class transcription factor isoform 3
SwissprotQ9LES32e-81AI5L2_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 2
TrEMBLA0A061FS300.0A0A061FS30_THECC; BZIP domain class transcription factor isoform 3
STRINGPOPTR_0008s01130.11e-168(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56850.18e-68ABA-responsive element binding protein 3
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]